Ch.va-SELENOT-1-U

General Information

Protein ID
312 
External ID
 

Protein Information

Protein Name
Ch.va-SELENOT-1-U 
Family
SELENOT 
Species
Chlorella variabilis 
Genome
GL433852 
EST
gi|208925109|gb|GE260751.1|GE260751 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGCCCGCCGCGCAGCTAAGCGCGGCGCAGGAGACTGCTCCCACCGCCCCAAGCGGCGTGCTCCTCTCCTTCTGCGTCAGCTGATCCTTCAAAGGCGCTGCGTTGCAAGTGCAACAAGCGCTGAAGAACCACTTTGGGCAGTCGCTGCCCGTCACCCTAGTCAACCACCCGCCGCCGCCCACCCAGGCGCTGCTGGCCCAGCTGGTGCTCCTGACGCAGTTTGTGCTGGCGGCCGTGGTGCTGTCAGGGCCGCAGGCCGCGCCGTACCTGGCTCGTATAGGCATCGTGCTTCCGCCCGAGACCTGGCAGGCTGTGCAGGAGAAGAAGGTCGGCATCCTCATGGGAGCCTGGTTCATCGGCAACACGGTCCGCCAAAACCTGCTGGGGACGGGCGCCTTTGAAGTCTCCTACGATGGCACCCCGATCTTCTCCAAGCTAGACACAGGGCGCATGCCTACTCTGCCCGAGCTGGTCGCCGGCATCGCCGAGGCAATGGCGGCTGCCGGCAACCCCGCAGGCAGTGGCACCGAGCAGTAG 
Protein Sequence
MPAAQLSAAQETAPTAPSGVLLSFCVSUSFKGAALQVQQALKNHFGQSLPVTLVNHPPPPTQALLAQLVLLTQFVLAAVVLSGPQAAPYLARIGIVLPPETWQAVQEKKVGILMGAWFIGNTVRQNLLGTGAFEVSYDGTPIFSKLDTGRMPTLPELVAGIAEAMAAAGNPAGSGTEQ* 
SECIS Sequence
VLLSFCVSUSFKGAALQVQQALKNHFGQSLPVTLVNHPPPPTQALLAQLVLLTQFVLAAVVLSGPQAAPYLARIGIVLPPETWQAVQEKKVGILMGAWFIGNTVRQNLLGTGAFEVSYDGTPIFSKLDTGRMPTLPELVAGIAEAM 

Structure Picture