Mi.co-SELENOM-1-U

General Information

Protein ID
303 
External ID
 

Protein Information

Protein Name
Mi.co-SELENOM-1-U 
Family
SELENOM 
Species
Micromonas commoda 
Genome
CP001575 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
TTCCTGCTCTTCGCAGTCACCTTGGTGGCTGCAGAAGAGCAACACACCGCAACCTCCGACGTCAGCAGGATGGAGTTCCAGACTTGCAGCGGCTGACGACTCAACAAGCACCCCAGTCTCAAGGAGTTTTTCAAGGAGACTGTGGACAAGGGGCTCATCGACGGGGTGCGCGTGAGATACATCCCCGGGAACGCGCCCGAACTCGTGATGTTCGACATGACCGGAAAGGAAAAAGAGCGGATAAATTTGGAGAAGATGAGCGTGACGGAGATCAAGATGTTGCTCGCCTCGCACGGGTTC 
Protein Sequence
FLLFAVTLVAAEEQHTATSDVSRMEFQTCSGURLNKHPSLKEFFKETVDKGLIDGVRVRYIPGNAPELVMFDMTGKEKERINLEKMSVTEIKMLLASHGF 
SECIS Sequence
UGGGUGCCGAGUGAUCUGAGAUCGCCGCGUGAUGACGUCUGCACCGAAAAGCGCGAUGACGUGCUCGGUUCAGGCCGAUAUAAGAGCGACCGAAGCCUAA 

Structure Picture