Mi.pu-MSRA-2-U

General Information

Protein ID
298 
External ID
 

Protein Information

Protein Name
Mi.pu-MSRA-2-U 
Family
MSRA 
Species
Micromonas pusilla CCMP1545 
Genome
GG663737 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ACGAACGACGCCGCGACGACGTCCTCGTCGACGACGTCGACCGAGACGGCCGTCTTCGCGATGGGATGATTCTGGTCTCCGGAGGAGACCTTCTCCTCCATCGAAGGCGTGCTCTCCACCAGGGTCGGGTACACCGGCGGGGACGCGCCGAGCCCGTCGTACGGCAGCGTCTGCGCGGGCGACGGGCACACGGAAGCGCTGAAGATCGAGTTCGACCCCTCCGTGGTGTCGTATCGATCGCTCCTCGACGTGTTCCTCGCCCAGCACGACCCGTGCGTCTCGTTCACGACGCAGTATCAGTCCGCGGTGTGGCCGACGACGGAGGCGCAGAAAAACGCGGTGATGGACGCCCTCGACGCGTACGAAGCGAAGCGCGGGCGCGCCGCGATGACGACGGTGGCGCCGCCGAAGGCGTGGCACGACGCGGAGTGGTACCACCAGCGGTACAACGCGAAGAACAAAATACGACTGGCGCTGTTCGCGGGGGTGTTCGCGTGCAACGCGCTCCCGCACGGGTCGTTCCCGGGACAAGAGCAGCTGAAGACCGTGTTAGGGGGTCTGGTGTTCCTGTCGTTGCTCCCGCAGCTGTTCGCGCCGATCGACAACGTGCTCTCGAAGTTCGAC 
Protein Sequence
TNDAATTSSSTTSTETAVFAMGUFWSPEETFSSIEGVLSTRVGYTGGDAPSPSYGSVCAGDGHTEALKIEFDPSVVSYRSLLDVFLAQHDPCVSFTTQYQSAVWPTTEAQKNAVMDALDAYEAKRGRAAMTTVAPPKAWHDAEWYHQRYNAKNKIRLALFAGVFACNALPHGSFPGQEQLKTVLGGLVFLSLLPQLFAPIDNVLSKFD 
SECIS Sequence
GGCGACGCGCCGCGACGACGCCCGCGCCACGUGACGCCGACCGGGCGAACUUCCCCACGUCGCGGGAAAGCCCGGCGCGGUCGAUGCGCGCGCGGGGCGUCGAC 

Structure Picture