Bo.br-SELENOT-1-U

General Information

Protein ID
285 
External ID
 

Protein Information

Protein Name
Bo.br-SELENOT-1-U 
Family
SELENOT 
Species
Botryococcus braunii 
Genome
 
EST
gi|339576873|gb|FY361381.1|FY361381 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGATCGCAGCGCGGTGCTTTGGTGTCTCCTGGGCCTGCTGTGTGTCAGCGATGTTTTCGCTTTGTTCAGACTGGAGACTCATGGATCTCCCGAAGAGCAGCCAAGCGCCGCCGTAGTTGACGTTGTTAGCCTGGGAGGAAAAGTTCACATTTCATATTGCTCTTCATGATCCATGAAGGGGGCCATGGGGCACGTGGTCCATGCCCTGCATGCTCGCTTTCCCTCGCTGGAAGTGGTTACCTCTGCATACCCCGTCCCTCCCCTTATGCAGCTGGGAGCCAGCCTGGTGGTACTGCTGCACGTGGGAGGTGCTGCTACTCTGCTCTTTGGCCAGCAGCTGTTCACCATCTTGGGCATGGGCGTGCCCCACTGGTACCTGCGGGCGCGGGAGCACCTCGGGCATGCTCTGGTTGCCATCTGGTTTGTG 
Protein Sequence
MDRSAVLWCLLGLLCVSDVFALFRLETHGSPEEQPSAAVVDVVSLGGKVHISYCSSUSMKGAMGHVVHALHARFPSLEVVTSAYPVPPLMQLGASLVVLLHVGGAATLLFGQQLFTILGMGVPHWYLRAREHLGHALVAIWFV 
SECIS Sequence
 

Structure Picture