1_Ba.pr_SELENOH_G

General Information

Protein ID
281 
External ID
 

Protein Information

Protein Name
1_Ba.pr_SELENOH_G 
Family
SELENOH 
Species
Bathycoccus prasinos 
Genome
NC_024002 
EST
 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATAACGTATAGTAAAAACTGAGACGGCGGCGGCCAAGAGTTTGAAGCGGCGAAAGCTGCCATCTTGGCCGTGGTGAAAAACGCGAACGTCGTTCCGAACAGAGTGGATAAGTATCCAATCACGGTGACCATCGAGGAGGAACAGTTAGGAATGATTTACAGCGGAAGGCAGCAAGGATTTTTCGGGAAAAACGGACGACCGGCGATGCGAGAGGTGGAGGAAGCGCTGAGG 
Protein Sequence
ITYSKNUDGGGQEFEAAKAAILAVVKNANVVPNRVDKYPITVTIEEEQLGMIYSGRQQGFFGKNGRPAMREVEEALR 
SECIS Sequence
 

Structure Picture