Co.su-SELENOH-1-U

General Information

Protein ID
279 
External ID
 

Protein Information

Protein Name
Co.su-SELENOH-1-U 
Family
SELENOH 
Species
Coccomyxa subellipsoidea 
Genome
KN714658 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCGCCCAAGAGAAAGGCAGCAACAGCTTCTGCGAAGGGCGAGGCGCTTGCTGTGAAGAAGACAAAGGCACCCAAGAAGGCGGAAGCTGAAAGAATTGCGGTTCCAGCTGCCACTTCTGACGGGACGAAGCTCTCTCTGATCATAGAGGCGTGTAAGTCATGAGGTGCGTTCAAAACGCGGGCAAACAAACTGGACAAGGCCATCAAGGAGGTTGATCCGGATGCTGAAGTATCAATCAACCCCGAGAAGCCTCGTAAGGGATGCTTTGAGGTCAGGAGTGCTGATGGCACGAAGACGTATGTTTCTCTTCTGGACATGCCTCGTCCATTCACGAAGCTCAAGGAGTTGGACATGGACGAGCTGGCCAAGGAAATTCTTGCAAGC 
Protein Sequence
MAPKRKAATASAKGEALAVKKTKAPKKAEAERIAVPAATSDGTKLSLIIEACKSUGAFKTRANKLDKAIKEVDPDAEVSINPEKPRKGCFEVRSADGTKTYVSLLDMPRPFTKLKELDMDELAKEILAS 
SECIS Sequence
AUGGAGCUUGUUGGUGGUGGCAUAUGCGAGUAUGACGCUCUGCUGGGGAACCAGAAAUGGACCAGCAGGGCUGAUCAGGGGGCCGCUCCGCAGGACUC 

Structure Picture