1_Al.ta_SELENOH_E

General Information

Protein ID
276 
External ID
 

Protein Information

Protein Name
1_Al.ta_SELENOH_E 
Family
SELENOH 
Species
Alexandrium tamarense 
Genome
 
EST
gi|40755775|gb|CK431937.1|CK431937 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCAGCCGACTCGGGGCCGCCAGGAAGGTTTCTGGTGGAGTATACCTCCAGCTGAGACGGAGGTGGACAGGAGCGGGACGCTGCCACCCGCTTCATCAAGGAGATCTTTGCTGATGCTGAGGTGGAGGCCAAGTGCGTGGGCGGCCCAGCGCAAGTAAGCATATCTTGCAATGGCGATAAGCTCGTTTCCGTGCGGCAGCGGGACCTTTACAAAAAGTACAGGTGGCCCGCAAAGCCGGAAATCCAAGAGGCATTGCGTGAATTGAAGAGCAAAAGCTAG 
Protein Sequence
MAADSGPPGRFLVEYTSSUDGGGQERDAATRFIKEIFADAEVEAKCVGGPAQVSISCNGDKLVSVRQRDLYKKYRWPAKPEIQEALRELKSKS* 
SECIS Sequence
 

Structure Picture