2_Em.hu_SELENOT_E

General Information

Protein ID
274 
External ID
 

Protein Information

Protein Name
2_Em.hu_SELENOT_E 
Family
SELENOT 
Species
Emiliania huxleyi 
Genome
 
EST
gi|37697756|gb|CF753963.1|CF753963 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
TCGTTTGCCGTCGTCGCGCGGCCGGCAATCGAGCGGCACGACTCGACGGTTCGGATCGAGTTCTGCCGCTCCTGACAGACGGCGGGCGCCTTCCGGCAGTGCGCTCTCGCGCTCCAGTCGGCGTTCCCCGGCGTGCCCATTGAGGGCGGCGATTACACACCTCCTGTGGGCGTGCAGTACGCCATCCGTACCGTGCGGGCGGCGCAGGCGCTGGTGGCTCTCAACTACTTCTTCGGAGAGCAGGCGGCGGCTGCGGTTCGGCGGCCAACGCCACGCGCAGACCTTCAAATGCACGATAATCCAATGCTCACAATCGGAGGCGCGTTCACTCTGAACATAGTCCCGCATACGCAACATACTGTCCATGCAATTGTAGAACCAAAAACAGACTTAAGAAAAACATCAGAAATGACACCGGTACAATACATACACACGGCGGTACTGCAAGGAGGGGGGAAGGAAGGAACTGGTGGGAAGAGCAAGGAGGGAGGGAGGGCGGAACGTGTGTGA 
Protein Sequence
SFAVVARPAIERHDSTVRIEFCRSUQTAGAFRQCALALQSAFPGVPIEGGDYTPPVGVQYAIRTVRAAQALVALNYFFGEQAAAAVRRPTPRADLQMHDNPMLTIGGAFTLNIVPHTQHTVHAIVEPKTDLRKTSEMTPVQYIHTAVLQGGGKEGTGGKSKEGGRAERV* 
SECIS Sequence
 

Structure Picture