Gl.no-SELENOM-1-U

General Information

Protein ID
273 
External ID
 

Protein Information

Protein Name
Gl.no-SELENOM-1-U 
Family
SELENOM 
Species
Glaucocystis nostochinearum 
Genome
 
EST
gi|106802758|gb|EC121135.1|EC121135,gi|106798350|gb|EC116727.1|EC116727,gi|106799774|gb|EC118151.1|EC118151,gi|106799520|gb|EC117897.1|EC117897,gi|106803495|gb|EC121872.1|EC121872 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCGAGGAGTATCGTTTTGACAGTATCTGTTTTCTGTGTCTTCTTTCTTTCACTAGTTTCCGCGGAGGTCTCCGATGCGGACCCTTTCGCAGTTGTTGCCGAACAACCCGCAAAACCTCAAGCAGCGCGTGTCGTATTAGAGACATGCAGCGGATGAAAATTAAACCGACTGCCCATTATTAAATCCTTCATCAACGAGGAAAGTGGGCAGTATCCTGCATTAGAAGTGAAGTATATACCAGGTCTGACGCCACGATTTATTTTCTACGACGAAGCTGGTGCCGAGCTAGAGCGCAAGGATATCGACACTTTCCAGAATGCCGAAGTGCATGATTACCTGCGCTCGTTCGGAATTAAGCGCGTTCTCCCATAG 
Protein Sequence
MARSIVLTVSVFCVFFLSLVSAEVSDADPFAVVAEQPAKPQAARVVLETCSGUKLNRLPIIKSFINEESGQYPALEVKYIPGLTPRFIFYDEAGAELERKDIDTFQNAEVHDYLRSFGIKRVLP* 
SECIS Sequence
GGACUCCCAAAACGGAAGGCGGUAGACGCGAAUGAUGUCGGCGCCCGAAAGGUGUAAUAGCACCGGGCGCGGACUGAAAUGCUUCCCCCUCCGAUAUUGUGAGGA 

Structure Picture