Th.oc-SELENOM-2-U

General Information

Protein ID
269 
External ID
 

Protein Information

Protein Name
Th.oc-SELENOM-2-U 
Family
SELENOM 
Species
Thalassiosira oceanica 
Genome
AGNL01047825 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAGATTATTCACTATCTTACTACTCGTGACCATGCAGTTGGCATTGGGACGGGAAGGTATCACTGGACTTATCGAGTCTTGCAGCGGATGAGCCCTCAACAAGCTACCACGGCTCAAAAGTTTTTTGAAGGAACCGGGCGGGGTTGATCTGTACAAGAACGTGGAGGTTAGGTTCATATCTGGGAGGAAGGCCGTTCTTACGATTTTC 
Protein Sequence
MRLFTILLLVTMQLALGREGITGLIESCSGUALNKLPRLKSFLKEPGGVDLYKNVEVRFISGRKAVLTIF 
SECIS Sequence
 

Structure Picture