1_Ph.tr_SELENOH_G

General Information

Protein ID
268 
External ID
 

Protein Information

Protein Name
1_Ph.tr_SELENOH_G 
Family
SELENOH 
Species
Phaeodactylum tricornutum 
Genome
CM000609 
EST
 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
AACTGAGATGGGGGCTACCAGGAGTATAGCACGGCTGAAAACTGTGTCAAGGAGATTTTCCCTGGTAGTCAGATTGTTGCCAATCGCACGGATCGTTATCCCATTCGTGTGATCGTGTCGGTTGAGGCTGACGGCAAATCAGTCGAAATTTGGAGCGGTTCGCAGCGAGACTTATTCCAGAAGTATCGCGCCAATCGAGAAAAGTCCGTCCAGGCGATCAAG 
Protein Sequence
NUDGGYQEYSTAENCVKEIFPGSQIVANRTDRYPIRVIVSVEADGKSVEIWSGSQRDLFQKYRANREKSVQAIK 
SECIS Sequence
 

Structure Picture