Au.an-SELENOM-3-U

General Information

Protein ID
265 
External ID
 

Protein Information

Protein Name
Au.an-SELENOM-3-U 
Family
SELENOM 
Species
Aureococcus anophagefferens 
Genome
ACJI01001837 
EST
gi|161690181|gb|FC044289.1|FC044289 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCTCCGGTCCATCCTGCTCGCCGCCGCCGCCGTGGGCGCGCGCGGCGGCCTCTTCTCGTCGAGCGAGCGCACCTGCGAGGTGGAGTCGTGCTCAACGTGATGGACGCAGCGGCTGCCCGTGGCCGACCAGTTCGTGAAGAACGAGGACGGCGCGGAGTCCTACGGCTGCACGGTGAACTACATCCCGCACCACCCGCCGGAGCTCGTCATCAAGGCGAACGGCCGCGAGCAGGAGCGCATCTCGCTCGAGCGCTTCCGGAACCCGAACGACATCCGGCGGCTCATGGAGAGCAAGGGCTTCGCGCAGACCGACGAGTACTTTAAAAAGCAGAAGGACAAGCGCGACGTCGAGTTCGTCGCGGGCCAGGAGGCCGACGTCTACTGGCTCGACGGCGACGGCGGCAAGCACCACAGCGGCATCGCGGAGGTCGGCGCGCCGCTCATGGTCTCGACGTACGTCGGCCACAACTTCGAGGTCCAGGACGGCTTCGGCGACCCCATCATCATGTACACGGTGTCGGAGAAGGCGAGGCAACGAGTTAGCATCCCGGCGGAGACGCCGGAGCTCTAG 
Protein Sequence
MLRSILLAAAAVGARGGLFSSSERTCEVESCSTUWTQRLPVADQFVKNEDGAESYGCTVNYIPHHPPELVIKANGREQERISLERFRNPNDIRRLMESKGFAQTDEYFKKQKDKRDVEFVAGQEADVYWLDGDGGKHHSGIAEVGAPLMVSTYVGHNFEVQDGFGDPIIMYTVSEKARQRVSIPAETPEL* 
SECIS Sequence
MLRSILLAAAAVGARGGLFSSSERTCEVESCSTUWTQRLPVADQFVKNEDGAESYGCTVNYIPHHPPELVIKANGREQERISLERFRNPNDIRRLMESKGFAQTDEYFKKQKDKRDVEFVAGQEADVYWLDGDGGKHHSGIAEVGAPLMVSTYVGHNFEVQDGFGDPIIMYTVSEKARQRVSIPAETPEL 

Structure Picture