Au.an-MSRA-1-U

General Information

Protein ID
26 
External ID
 

Protein Information

Protein Name
Au.an-MSRA-1-U 
Family
MSRA 
Species
Aureococcus anophagefferens 
Genome
ACJI01002526 
EST
 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGGGTCCTCCGTCGAGGGCGGCGCGTCGGCGCCGGCGGTGCGCCGGCGCTACACCGTCGTCGGGAAGCGCGGCGTCGTCGTGCGGGCGGGCGTGGAGCTCGACAGCCCCGTCGTGGCGCGGCTGCCCCGGGGCGCCGTCGTCGAGGGCGACGCGTCGTCGAGCGTCCCGGCGCGCCCGGGGGGCGCCCGCCTACGCGTCGCCGGCGGCTGGTGCGCGGCGCGCCTCGTCGCGCCGGGCCCGCTCGTCGGCGGGTGCGCGCCGCTCGCGGCGTCGCTCGGCCTGCCGCCGCGGCCCGAGGGCTACTTGTGCGACCTCGAGGCCGCGCCGCCGCCGCACGAGCGCCTCGAGGTCGCGACGGTCGCCCTCGGCTGATTCTGGGAGCCTCCGGCGCTGCTCCGGGCGACGCACGCCGGCGTGGCGGCCACGACCGTCGGCTACTGCGGCGGCCGCGCGCCGTGGCCGACGTACGGGGACATGGGCGACCACACGGAGGCCGTCCAGGTCCTGTACGACCCCGGCGTCACGACCTTCGACGACATCCTCAGATTTGTCCTGCCGAGCGGCGGGCGGAACCGGTCGCAGACGCGCCAGTACATGACCGCCGTCTGGCCCCACACGGACGCGCAGGCGGCCGCCGTCGCCGCGGCGACGCGCGACCTGCCCGAGGACTTCCTCTTCGTCGAGCCCTTTTCCTGCTTCTACCGCGCGGAGGATCCACCACCAGGGCCGGAGCTAGCGATGACGGGCGCGCGCGGCCCTCGGCCGCGCGCGCCCCGACGACGCCCGGCGCCC 
Protein Sequence
MGSSVEGGASAPAVRRRYTVVGKRGVVVRAGVELDSPVVARLPRGAVVEGDASSSVPARPGGARLRVAGGWCAARLVAPGPLVGGCAPLAASLGLPPRPEGYLCDLEAAPPPHERLEVATVALGUFWEPPALLRATHAGVAATTVGYCGGRAPWPTYGDMGDHTEAVQVLYDPGVTTFDDILRFVLPSGGRNRSQTRQYMTAVWPHTDAQAAAVAAATRDLPEDFLFVEPFSCFYRAEDPPPGPELAMTGARGPRPRAPRRRPAP 
SECIS Sequence
GUCUCCCACGAACUCUCCGCGUUCGUGAGCGCGUCCCUCGCCGCCGCCAAGCCCAAGAAGGACGGCGACGGCGACGACGCGGACGUCGGCGCGGCG 

Structure Picture