3_Mi.co_SELENOH_E

General Information

Protein ID
256 
External ID
 

Protein Information

Protein Name
3_Mi.co_SELENOH_E 
Family
SELENOH 
Species
Micromonas commoda 
Genome
 
EST
gi|255080905|ref|XM_002503973.1| 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGAGCGTCGCCAGCGGTGACACGTACACCGTGACGTTCTGCTCCAACTGAGACGGGGGCATGCAGGAGTTCGAGGCCGCGAAGGCCGCGATCCTGCAGGTGCATCCGGACGCGAACGTGGTCGGGAACAGGATCGACGAGTACCCGATCACTGTTACCGTGAGCAAGGGGGAGGACGTCATGTGGAGCGGCCGGCAGCAGGAGCTGTTCAGCCGGAACGGCCGGCGCGCGCAGGCGGACATC 
Protein Sequence
MSVASGDTYTVTFCSNUDGGMQEFEAAKAAILQVHPDANVVGNRIDEYPITVTVSKGEDVMWSGRQQELFSRNGRRAQADI 
SECIS Sequence
 

Structure Picture