1_Os.sp_SELENOH_E

General Information

Protein ID
251 
External ID
 

Protein Information

Protein Name
1_Os.sp_SELENOH_E 
Family
SELENOH 
Species
Ostreococcus sp. RCC809 
Genome
 
EST
gi|254311977|gb|GR822206.1|GR822206,gi|254312521|gb|GR824274.1|GR824274 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGTCTGGGGACGACGTGACGGTGACGTTCAGTCACAACTGAGACGGGGGGATGCAAGAATTCGAAGCCGCGAAAGCGGCGATTCTTAACGTGAGACCGAACGCGAACGTGGTGGCGAACCGGGTGGATAAATATCCAATCACGGTGACGGTTTCGTCGGGAGGTAAAGACGTCTGGAGCGGAAGACAACAGGGGTTGTTCCGTAAGAATGGACGACCGGCGATGAAAGAGATCGAAGACGCGATGCGTGGCTTGCAGTAA 
Protein Sequence
MSGDDVTVTFSHNUDGGMQEFEAAKAAILNVRPNANVVANRVDKYPITVTVSSGGKDVWSGRQQGLFRKNGRPAMKEIEDAMRGLQ* 
SECIS Sequence
 

Structure Picture