Th.ps-SELENOT-1-U

General Information

Protein ID
247 
External ID
 

Protein Information

Protein Name
Th.ps-SELENOT-1-U 
Family
SELENOT 
Species
Thalassiosira pseudonana 
Genome
CM000639 
EST
gi|162386196|gb|FC527804.1|FC527804 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCACCGTCCTCCTCCCTCGATCCGCGTGTTCGTCACCGTGCTAACATGACGTGCTCGTTGCACTACTTTATCTCTTCGCACCTACACCTACCAAGGAACCCAACACACAAAACCTACACAAAGCCTTTGTCCAGTTTTGCACTCAATGAGGTATGAAGGCCAACTTTCTCCGCGTACGCGAGATTCTCATCAATGAATTTCCTGGACAATGGAGCAGTATTGAAGGAGAAAACTACCCGGCTCCTGAATGGACTAAGTTGGCTGGAAGTGTGGTATCAGCGTTGCAAATATTTGTTATGGTGTTGGTGATGGTTGGAGATTCTATTTGGAGTTATATCCCTGGTTTTAGACGGGGTCCTCCCGAGGTGTACTACAAGTTGAAGGATAATCCGGCGTTGGCTTTGATTGGAGTCTTTTTGATCATTCCCTCGTACATTCAATCATTTGCAAATACTGGAGCTTTTGAAATCATGTTGGATGGGAAAGTGATATTCTCAAAGTTGGAGTTGGGGAGAATGCCAAACGTTGCCGAGATCATTAAAGCAGTAGAAAGTGCTGGATTGCATCGAGGTAGATAG 
Protein Sequence
MHRPPPSIRVFVTVLTJRARCTTLSLRTYTYQGTQHTKPTQSLCPXCTQUGMKANFLRVREILINEFPGQWSSIEGENYPAPEWTKLAGSVVSALQIFVMVLVMVGDSIWSYIPGFRRGPPEVYYKLKDNPALALIGVFLIIPSYIQSFANTGAFEIMLDGKVIFSKLELGRMPNVAEIIKAVESAGLHRGR* 
SECIS Sequence
MHRPPPSIRVFFCTQUGMKANFLRVREILINEFPGQWSSIEGENYPAPEWTKLAGSVVSALQIFGMVLVMVGDSIWSYIPGFRRGPPEVYYKLKDNPALALIGVFLIIPSYIQSFANTGAFEIMLDGKVIFSKLELGRMPNVAEIIKAVESAGLHRGR 

Structure Picture