Is.ga-SELENOM-1-U

General Information

Protein ID
244 
External ID
 

Protein Information

Protein Name
Is.ga-SELENOM-1-U 
Family
SELENOM 
Species
Isochrysis galbana 
Genome
 
EST
gi|106818001|gb|EC136378.1|EC136378 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGATCTGCGATGCCGACAAGTCGCGCATCGCGCGCGGCGAGATCCGCACGTGCTCTGGGTGAAAACTGAACCTGTATGCCGAGGTGCGCGACTTCGTCATGTCGGAACAACACGCTGGGCGGTACCTGAACGTCAAGGTCCAGTTCATCAATCACCACAATCCAGATCTGGTGCTGCTGGCTGCGGAC 
Protein Sequence
MICDADKSRIARGEIRTCSGUKLNLYAEVRDFVMSEQHAGRYLNVKVQFINHHNPDLVLLAAD 
SECIS Sequence
 

Structure Picture