Gu.th-SELENOH-1-U

General Information

Protein ID
239 
External ID
 

Protein Information

Protein Name
Gu.th-SELENOH-1-U 
Family
SELENOH 
Species
Guillardia theta 
Genome
AEIE01002901 
EST
gi|557428909|gb|HE990893.1|HE990893,gi|117382343|gb|EG716798.1|EG716798 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCGGGAAAGCGAAAGAGCGCTGGAGGGGAGGGAAAGGCGTCGAAGAAGGCGGCGAAGGTGGAGAAGGACGAGAAGGTGGAGAAGGTTGAGAAGGGAGAAGAGGCTGCATCCTCCTCTGCTGCTTCTAACTCAGTCATCATCGAGCACTGTAAAAGCTGAGGAGCATTCAAGACAAGAGCGGCCAAACTAGAGAAACTCCTGAAGGAGGCGAAGATCTCTGTTGAAATCAATCCAGAGAAACCGAGGAAGGGATGCTTCGAGGTTCGTCTGGGCAACGGAGACAAGATCGTCTCCTTGCTCGACATGCCGAGACCCTTCACCAAGCTCAAGGCACTTGACATCGACGAGGTTGCTGAGAAAGTCAAGGCAGCTGTGTAG 
Protein Sequence
MAGKRKSAGGEGKASKKAAKVEKDEKVEKVEKGEEAASSSAASNSVIIEHCKSUGAFKTRAAKLEKLLKEAKISVEINPEKPRKGCFEVRLGNGDKIVSLLDMPRPFTKLKALDIDEVAEKVKAAV* 
SECIS Sequence
MAGKRKSAGGEGKASKKAAKVEKDEKVEKVEKGEEAASSSAASNSVIIEHCKSUGAFKTRAAKLEKLLKEAKISVEINPEKPRKGCFEVRLGNGDKIVSLLDMPRPFTKLKALDIDEVAEKVKAAV 

Structure Picture