Co.su-SELENOT-1-U

General Information

Protein ID
238 
External ID
 

Protein Information

Protein Name
Co.su-SELENOT-1-U 
Family
SELENOT 
Species
Coccomyxa subellipsoidea 
Genome
KN714654 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
CCCGAGTCTTCAACAACCCAAGGCCCTGTCTCAGATCAGCTTAGCGAGGGTGGCAAAGTGCACATCAGCTTCTGCAGCTCCTGAGGGTACAAGGGGGCTTTCATGCAGGCGCAGCAGGTGCTGCGACAGAGGTTCCCCGGCATGGAAGTCGTCCCTTCGACCTATCCTGTATCAGCTCAGAGGGCAGCCCTGGGGAGGGTAGTGATGGGGCTCCAGTTTGGGGGCATCGCAGTGGTGCTCGGGGGAGACAGAATATTCCCCGCGCTGGGCATGGAGATGCCCCAGGTGCTGGCGCAGATGCGCGAGAAGAAGATGGGAGTGGTGATGGGCATCTGGCTGCTGGGCAACGCGCTGCAGAACCAGCTGAGCGCCACGGGAGCCTTTGAGGTTTACTTTGACGGCAAGCAGATGCACAGCAAGCTGGAGACAGGGCGCGTGCCTTCCATGGACGAGCTGGTCAGCTCCATAGAGCTCGCAATGGGC 
Protein Sequence
PESSTTQGPVSDQLSEGGKVHISFCSSUGYKGAFMQAQQVLRQRFPGMEVVPSTYPVSAQRAALGRVVMGLQFGGIAVVLGGDRIFPALGMEMPQVLAQMREKKMGVVMGIWLLGNALQNQLSATGAFEVYFDGKQMHSKLETGRVPSMDELVSSIELAMG 
SECIS Sequence
ACUCUGGGUGCUGGCGCAGCAGUGCGAGAUAUGACGGCUGAGCAGUAAGCAGCGAUGAGCUGUGUGCAAGCCUGAGAUAAGCAUUCUGUGUCAGCCCUAA 

Structure Picture