Au.an-SELENOM-1-U

General Information

Protein ID
233 
External ID
 

Protein Information

Protein Name
Au.an-SELENOM-1-U 
Family
SELENOM 
Species
Aureococcus anophagefferens 
Genome
ACJI01001353 
EST
gi|161671405|gb|FC025074.1|FC025074 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCTGCGACGACTCGTGCTCGCGTGCGCCGCGGCGCTCGCGGCCGCGGCCACGGGCAAGATCGAGACTTGTTCTGCGTGAAAGTTAAATAAGCTCCCTGAAGTGAAGCGATTCGTCAAGGAGAGCGGGCACGCCGACACCTACGAGGGGCTGGAGATCGACTACGTGCGCGGCAAGCCGCCGACGCTGATCATGATGGACGGCGACGCCGAGGTCGAGCGCGTCGACCTCGCGCCGTACTCGACGGACGAGCTCCACGCGCTCATGCAGGAGAAGGGCTTCGCGCGCAAGGAGGCCGAGCCGGCGGGGACGCGCGAGCAAGTGCTGCACCGCGCGCCCCGCAGCGCCCAGGCCGACGCCGTCGCCGACGCGGAGACGACGCTCTAG 
Protein Sequence
MLRRLVLACAAALAAAATGKIETCSAUKLNKLPEVKRFVKESGHADTYEGLEIDYVRGKPPTLIMMDGDAEVERVDLAPYSTDELHALMQEKGFARKEAEPAGTREQVLHRAPRSAQADAVADAETTL* 
SECIS Sequence
MLRRLVLACAAALAAAATGKIETCSAUKLNKLPEVKRFVKESGHADTYEGLEIDYVRGKPPTLIMMDGDAEVERVDLAPYSTDELHALMQEKGFARKEAEPAGTREQVLHRAPRSAQADAVADAETTL 

Structure Picture