1_Ch.re_SELENOM_E

General Information

Protein ID
232 
External ID
 

Protein Information

Protein Name
1_Ch.re_SELENOM_E 
Family
SELENOM 
Species
Chlamydomonas reinhardtii 
Genome
 
EST
gi|14225880|gb|BG844696.1|BG844696 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCGGGCGCTCGCCTTGGCGCTCCTGGCGCTGGCTTTGATTGCGCAGCAAGCAAATGCCAAGGTCGCTCGTGGCGAGTTCATCAGCTGTCCCGGCTGACGCCTGAACCACCTGCCGGAGGTTTAAGAAGTTCATTCGAGGGGACATCGAGAAGGATAAGGCCTACGAGAACCTCACAGTGAACTTCGTCCCCGGCAGGACCCCTGAGCTCGTGCTCTACGATGAGAATGGCGTGGAGATTGAGCGTATGTTCGTGGACAAGCTCAAGTACGACGAGCTCCACACGTTAGTGCAGAGCAAGGGCTTCAAGCGGAGAGACCCCAACGCTGCAGCGGCAACCACCACCGCTACCGCATCCACACGGCGTGCGCGCGCGGCTCGTCGCCTTCTCAGGGCGACAGAGGAGACCGCTTGCTAG 
Protein Sequence
MRALALALLALALIAQQANAKVARGEFISCPGURLNHLPEVXKFIRGDIEKDKAYENLTVNFVPGRTPELVLYDENGVEIERMFVDKLKYDELHTLVQSKGFKRRDPNAAAATTTATASTRRARAARRLLRATEETAC* 
SECIS Sequence
 

Structure Picture