1_Me.vi_SELENOH_E

General Information

Protein ID
227 
External ID
 

Protein Information

Protein Name
1_Me.vi_SELENOH_E 
Family
SELENOH 
Species
Mesostigma viride 
Genome
 
EST
gi|60426107|gb|DN257497.1|DN257497 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCATCAGCTTCTGGGGCCAACTTTATCGTTGAGTTCTGCCGCAACTGAGACGGGGGGCAACAGGAGTTCAATGCAGCTAAGGAGGCGATCCTGCGGGTCCACCCGCAGGCGGTCGTCAAGCCGGACTGCTTGGACTCCTATTTCTTCCAGGTGCGCGTGAAGGAGGCCGGCAGCGTGTGCGTGCTGTGGAAAGGCGACCAGCGCGCGCTCTTCCGCAAGTACGCGTCCCAGCGCTCCGCGTCGCAGGAGGAGATCGCGCGCGCGGTGCAGGAGCTGGGGGGTCTGCCCCCAACCACAAACTAG 
Protein Sequence
MASASGANFIVEFCRNUDGGQQEFNAAKEAILRVHPQAVVKPDCLDSYFFQVRVKEAGSVCVLWKGDQRALFRKYASQRSASQEEIARAVQELGGLPPTTN* 
SECIS Sequence
 

Structure Picture