Mi.co-SELENOM-2-U

General Information

Protein ID
207 
External ID
 

Protein Information

Protein Name
Mi.co-SELENOM-2-U 
Family
SELENOM 
Species
Micromonas commoda 
Genome
CP001577 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GCCCACAGCGCCATGCGCCTCCTCGCCTTGGCTCTGGCGCTCCTGGCGGCGTCCACCGCCCCTTCGGTGGACGCCGCCCGTCACCTCCGCTCATCGGATACCGCCGAGCACATCGGCAGAGCCGAGTTCGTCTCGTGTCCCGCGTGACGTCTCAACAAGTACCCGGAGCTGAAGCGGTTCCTGAAGGTTGAGGTTGAGAAGGAGCGGGCGTACCCGGGGGTGGGCGTCAAGTGGGAGCGTGGCCACCCGGTCACGCTGGTGCTCTACGACGAATTAGACAAGGAGGTGGAGAGACATAACATGGAGGGATGGGAGGTTGACAAGGTGCGCGACATGCTGCACGCGCGGGGGTTCCACAAGAAGGCCGCGGACAAGCTGCCCGGGGTGAAGATCGGTTTCAACTGGCTCGGGAGCAAGAGCGGCGAGGCCGACCGGTCCAATCACAGGACCCAGCCGCTG 
Protein Sequence
AHSAMRLLALALALLAASTAPSVDAARHLRSSDTAEHIGRAEFVSCPAURLNKYPELKRFLKVEVEKERAYPGVGVKWERGHPVTLVLYDELDKEVERHNMEGWEVDKVRDMLHARGFHKKAADKLPGVKIGFNWLGSKSGEADRSNHRTQPL 
SECIS Sequence
CACAAGAAGGCCGCGGACAAGCUGCCCGGGGUGAAGAUCGGUUUCAACUGGCUCGGGAGCAAGAGCGGCGAGGCCGACCGGUCCAAUCACAGGACCCAGCCGC 

Structure Picture