Th.oc-SELENOM-1-U

General Information

Protein ID
20 
External ID
 

Protein Information

Protein Name
Th.oc-SELENOM-1-U 
Family
SELENOM 
Species
Thalassiosira oceanica 
Genome
AGNL01021200 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
TTACTACTCGTGACCATGCAGTTGGCATTGGGACGGGAAGGTATCACTGGACTTATCGAGTCTTGCAGCGGATGAGCCCTCAACAAGCTTCCTCGGCTCAAAAGTTTTTTGAAGGAACCGGGCGGGGTTGATCTGTACAAGAACGTGGAGGTTAGGTTCATATCTGGGAGGAAGGCCGTTCTTACGATTTTCAATGACGGACGGGAGCTAGAGAAGATAACACTCAGCGATTACGATGACAAAAAGCAGCTCCACGAATTGTTCAAACAGAAGGGGTTC 
Protein Sequence
LLLVTMQLALGREGITGLIESCSGUALNKLPRLKSFLKEPGGVDLYKNVEVRFISGRKAVLTIFNDGRELEKITLSDYDDKKQLHELFKQKGF 
SECIS Sequence
 

Structure Picture