Th.ps-SELENOM-1-U

General Information

Protein ID
152 
External ID
 

Protein Information

Protein Name
Th.ps-SELENOM-1-U 
Family
SELENOM 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162369117|gb|FC511400.1|FC511400 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCTATCATCCGCCTCCCGCATACTCTTTCTCCTAGCAACCATCCTGGCCCTAACCACCGCCACCCTCCACGGAAGAATTGAATCCTGCTCTGGATGAAAATTGAACAAGCTTCCAGTTCTCAAATCCTTCCTAAAAGATGGAGAGGCAGAATCGTATAGAAACGTGGAGGTGAAGTATGTTCCTGGGAAACAGGCTGTATTGACGATTTATGAGGGTGAAGGGGAGGAGGTGGAGGGATGGGTGGAGAAAGAGAAGATTGTGTTGAGTGAACTCGAGACCAAGGTGACTGTTGTTTGGGTGTTGACTGAATGTTGTTTTATGTGTTGCAATTCAGCTGTATTTATTTATCTTGGTGCTTTTTCTTGA 
Protein Sequence
MLSSASRILFLLATILALTTATLHGRIESCSGUKLNKLPVLKSFLKDGEAESYRNVEVKYVPGKQAVLTIYEGEGEEVEGWVEKEKIVLSELETKVTVVWVLTECCFMCCNSAVFIYLGAFS* 
SECIS Sequence
 

Structure Picture