Gu.th-MSRA-1-U

General Information

Protein ID
149 
External ID
 

Protein Information

Protein Name
Gu.th-MSRA-1-U 
Family
MSRA 
Species
Guillardia theta 
Genome
AEIE01001504 
EST
gi|557428818|gb|HE990802.1|HE990802,gi|117383364|gb|EG717819.1|EG717819 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTTTCAGCGGTGCCCACTACGTAGCTCCCCTGTCGACGAGTCCCTCAGCATTGCTACCTTTGCCCTTGGGTGATTTTGGCATCCAGAGGCTGCTCTTGGAGCGGCCTCTGGTGTGAAGAGGACTAGGGTTGGCTACTGCGGAGGAAAGCAGAAGGATCCGACCTATCGCAAAGTTTGCTCTGATCCTATCTATGCGGATTGGGCAGAAGCTGTGCAGGTCGAGTTTGATGAATCGTCGATAAGCTACGCTGAGCTTGTCGAGCATTTCTTTCGCTCTCATGACGCGTCCTTCGGAAGTGGCAAAAGGCAGTACATGTCAGCAATCTTCTACCACTCTGAAGAACAGGAGAAGACTGCGCAACAAGTTCTGAGCAATTTCAATACACAGAAACGTGTGGTGACTGTAATCGAACCGGCGACGGACTTCTACGATGCAGAGTTGTATCACCAGAAATGGCTGCTGCAGAGGCGGAGAGACTGGTTTGCAACATTGGAGCTCATGTCGCCTGAAGAT 
Protein Sequence
MFQRCPLRSSPVDESLSIATFALGUFWHPEAALGAASGVKRTRVGYCGGKQKDPTYRKVCSDPIYADWAEAVQVEFDESSISYAELVEHFFRSHDASFGSGKRQYMSAIFYHSEEQEKTAQQVLSNFNTQKRVVTVIEPATDFYDAELYHQKWLLQRRRDWFATLELMSPED 
SECIS Sequence
SPVDESLSIATFALGUFWHPEAALGAASGVKRTRVGYCGGKQKDPTYRKVCSDPIYADWAEAVQVEFDESSISYAELVEHFFRSHDASFGSGKRQYMSAIFYHSEEQEKTAQQVLSNFNTQKRVVTVIEPATDFYDAELYHQKWLLQRRRDWFA 

Structure Picture