Ka.ve-MSRA-1-U

General Information

Protein ID
139 
External ID
 

Protein Information

Protein Name
Ka.ve-MSRA-1-U 
Family
MSRA 
Species
Karlodinium veneficum 
Genome
 
EST
gi|106839145|gb|EC157522.1|EC157522 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAAACCGGATACCGAGAAGGTCAGGAAGGTATTCAATGTCATTGTGAAAGGGGTTTTCGTGCGAAACCGTCCTGATGTGAAAGGAATCTGCATAGGAGCATTTAAGCAGGGTACGCATATAAGTGGTGTAGTCAGAAATGGTTGGTTGCAATTGGACGAGCAGAGTAAAAAAGAAGCCTCCGTGCGAAGCCGCCACCAGGACGCGTTCGTGTTGATCGATGCTACTGAGTTGAATCTAGGAGTTCTACTAGAAGAAGTACACGTCGAGTCTGCATCAAAGGCTGTCAGTTCAAAAAGTTCTTCTTCGGGCGGCGGTGTCAGAATTGCCACTTTCGCATTGGGATGATTTTGGGAGCCACAACCTCAATTTGATGAGTTGGAAGGGGTTATTCGAACATCAGTCGGGTATACGGGTGGAGCAAGTAAGAATCCATCTTATGTAAGCGTTTGCAATGGTGATGGACACACTGAAGCTGTTCGTGTCGAGTATGATTCTGAGCACATATCGTACCAAGACCTATTGGACAAATATTGGGACATTTATGTTGGTCCTGGTGGCAAGGCCCAA 
Protein Sequence
MKPDTEKVRKVFNVIVKGVFVRNRPDVKGICIGAFKQGTHISGVVRNGWLQLDEQSKKEASVRSRHQDAFVLIDATELNLGVLLEEVHVESASKAVSSKSSSSGGGVRIATFALGUFWEPQPQFDELEGVIRTSVGYTGGASKNPSYVSVCNGDGHTEAVRVEYDSEHISYQDLLDKYWDIYVGPGGKAQ 
SECIS Sequence
 

Structure Picture