Me.vi-SELENOH-1-U

General Information

Protein ID
134 
External ID
 

Protein Information

Protein Name
Me.vi-SELENOH-1-U 
Family
SELENOH 
Species
Mesostigma viride 
Genome
 
EST
gi|110041851|gb|EC727734.1|EC727734,gi|110044125|gb|EC730008.1|EC730008 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCTCCCAAACGGAAACCTGCTGCCAAAGAAGGCGAGGCACCTGCTAAAAGGCCTAAGGAAAATTCGGCCGAAACGGCTAAGACAGGGCCGAGCGTCGCCGGTACTAAGTCGCGTGTCACGGTCGAGGCATGCAAGCAGTGAGGTGCATTCAAAACGAGGGCGGTAAAGTTGGAAAAATACATTAAAGAATCGGATGTTGGAAGCCGCGTGGAGGTTGTTATTAATGAAGTACCCCCTCGTCGCGGATGTTTCGAGGTCCGCGTGGGAGACGAGGCGGTGGTTTCCTTGTTGGACTTGAAGCGGCCATTCCCAGCCTTGAAGGCGCTTGACATGGACGACATAGGAGCCAAGGTCGTGGAGAAGCTGAAGGCAAAGTGA 
Protein Sequence
MAPKRKPAAKEGEAPAKRPKENSAETAKTGPSVAGTKSRVTVEACKQUGAFKTRAVKLEKYIKESDVGSRVEVVINEVPPRRGCFEVRVGDEAVVSLLDLKRPFPALKALDMDDIGAKVVEKLKAK* 
SECIS Sequence
AGCCCAUAGCAUAAUUUCACCAUGUGAGCGGUGACGCUGCGCAAGGAAAUCACGAGCACUCACGUGACUUGCAGUGGCUGAUGCAUUUUCAACUCAUGUUGCACAUG 

Structure Picture