Pr.pa-SELENOM-2-U

General Information

Protein ID
129 
External ID
 

Protein Information

Protein Name
Pr.pa-SELENOM-2-U 
Family
SELENOM 
Species
Prymnesium parvum 
Genome
 
EST
gi|383202276|gb|HE782362.1|HE782362 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCGGTGGCTCCTCGCTTTCGGGCTGCTGGCTGGCTCTGCCGCCGGATCTCTTCGCGGCGTGGTCGAGACGTGCTCTAGGTGAAAGCTCAACCGGTATCCGAGCATCAAGCGCTTCGTGAATCTTGAGCCGGAGAACTTCCTTCACAAGTACGAGAGTCTGGAGGTCAAGTTCATCCCGGGGCACAACCCGGACCTCGTTGTGTACGACGGCGAGGTCGAGAAGGAGCGCATCGATCTCACGAAGATTAAGGGCAACTCAGGCCCTGAAATCGCCGACATCGAAGCTTTGCTCGCCAGCAAAGGCTTCAGGCGGAAGGGGGAGGAGCAGCCGAGCCCGTCGTCCACGCCGTCGTCAGCACCCGAAACCGCCGGCTGCGAGGACCAAGTGCTCGGCTGTGAGGTTTGGGCGAAGAAAGGCGAGTGCGAGAAGAACCCTTTGTACATGAAGAAGACTTGCCCCAAGAGCTGTGGGACGTGCCCAGACACAGCTGGGGCGAGCAAGGATGAGGTGTAA 
Protein Sequence
MRWLLAFGLLAGSAAGSLRGVVETCSRUKLNRYPSIKRFVNLEPENFLHKYESLEVKFIPGHNPDLVVYDGEVEKERIDLTKIKGNSGPEIADIEALLASKGFRRKGEEQPSPSSTPSSAPETAGCEDQVLGCEVWAKKGECEKNPLYMKKTCPKSCGTCPDTAGASKDEV* 
SECIS Sequence
 

Structure Picture