Em.hu-SELENOT-1-U

General Information

Protein ID
119 
External ID
 

Protein Information

Protein Name
Em.hu-SELENOT-1-U 
Family
SELENOT 
Species
Emiliania huxleyi 
Genome
KB869421 
EST
gi|261438558|gb|FP187327.1|FP187327,gi|208637508|gb|GE191378.1|GE191378,gi|261438672|gb|FP198901.1|FP198901,gi|208429301|gb|GE168500.1|GE168500,gi|208410078|gb|GE149980.1|GE149980 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCCGGCGGCCTCACATCGAACCAGAAAGCGCTCTTTGGCCTGGCCGCGCTCCTCTGCGGGCCTGCGCTGCTCAAGAGGTTTTACGAGAAGCCGAGCTCAGTCGACCTCTCATCGTTTGCCGTCGTCGCGCGGCCGGCAATCGAGCGGCACGACTCGACGGTTCGGATCGAGTTCTGCCGCTCCTGACAGACGGCGGGCGCCTTCCGGCAGTGCGCTCTCGCGCTCCAGTCGGCGTTCCCCGGCGTGCCCATTGAGGGCGGCGATTACACACCTCCTGTGGGCGTGCAGTACGCCATCCGTACCGTGCGGGCGGCGCAGGCGCTGGTGGCTCTCAGCTACTTCTTCGGAGAGCAGGCGGCGGCTGCGGTTCGGCGGCCGACGCCGCGCGCGGTCCTTCAGATGCACGATAATCCGATGCTCGCGATCGGCGGCGCGTTCGCTCTGGACGTGGTCGCGCAGACGCTGCAGTCGATCAATGCGTTTGAGGTAACCTACAACGGCCAGAAGCTGCACTCCAAGCTTGCCACCGGTCGGATGCCCCAGCCGGTGGAGCTGGTTCGGCAGCTCGAGACGATGCGCGCAAAGGAGAAGACGCGCACGCAGGGAGCGGCGGAGGCGTCGGCGCCCAAAGTGCGCATCGAGTAG 
Protein Sequence
MAGGLTSNQKALFGLAALLCGPALLKRFYEKPSSVDLSSFAVVARPAIERHDSTVRIEFCRSUQTAGAFRQCALALQSAFPGVPIEGGDYTPPVGVQYAIRTVRAAQALVALSYFFGEQAAAAVRRPTPRAVLQMHDNPMLAIGGAFALDVVAQTLQSINAFEVTYNGQKLHSKLATGRMPQPVELVRQLETMRAKEKTRTQGAAEASAPKVRIE* 
SECIS Sequence
VRIEFCRSUQTAGAFRQCALALQSAFPGVPIEGGDYTPPVGVQYAIRTVRAAQALVALSYFFGEQAAAAVRRPTPRAVLQMHDNPMLAIGGAFALDVVAQTLQSINAFEVTYNGQKLHSKLATGRMPQPVELVRQLETMRAKEKTR 

Structure Picture