1_Mi.pu_MSRA_Mg

General Information

Protein ID
118 
External ID
 

Protein Information

Protein Name
1_Mi.pu_MSRA_Mg 
Family
MSRA 
Species
Micromonas pusilla CCMP1545 
Genome
GG663737 
EST
gi|303275252|ref|XM_003056878.1| 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCGGCGTTCTCTGCCCTCGCCGCGCCCGCGGCGCACCCCGCGCGGGAGACCTTCTCCTCCATCGAAGGCGTGCTCTCCACCAGGGTCGGGTACACCGGCGGGGACGCGCCGAGCCCGTCGTACGGCAGCGTCTGCGCGGGCGACGGGCACACGGAAGCGCTGAAGATCGAGTTCGACCCCTCCGTGGTGTCGTATCGATCGCTCCTCGACGTGTTCCTCGCCCAGCACGACCCGTGCGTCTCGTTCACGACGCAGTATCAGTCCGCGGTGTGGCCGACGACGGAGGCGCAGAAAAACGCGGTGATGGACGCCCTCGACGCGTACGAAGCGAAGCGCGGGCGCGCCGCGATGACGACGGTGGCGCCGCCGAAGGCGTGGCACGACGCGGAGTGGTACCACCAGCGGTACAACGCGAAGAACAAAATACGACTGGCGCTGTTCGCGGGGGTGTTCGCGTGCAACGCGCTCCCGCACGGGTCGTTCCCGGGACAAGAGCAGCTGAAGACCGTGTTAGGGGGTCTGGTGTTCCTGTCGTTGCTCCCGCAGCTGTTCGCGCCGATCGACAACGTGCTCTCGAAGTTCGACTGA 
Protein Sequence
MAAFSALAAPAAHPARETFSSIEGVLSTRVGYTGGDAPSPSYGSVCAGDGHTEALKIEFDPSVVSYRSLLDVFLAQHDPCVSFTTQYQSAVWPTTEAQKNAVMDALDAYEAKRGRAAMTTVAPPKAWHDAEWYHQRYNAKNKIRLALFAGVFACNALPHGSFPGQEQLKTVLGGLVFLSLLPQLFAPIDNVLSKFD* 
SECIS Sequence
TSSSTTSTETAVFAMGUFWSPEETFSSIEGVLSTRVGYTGGDAPSPSYGSVCAGDGHTEALKIEFDPSVVSYRSLLDVFLAQHDPCVSFTTQYQSAVWPTTEAQKNAVMDALDAYEAKRGRAAMTTVAPPKAWHDAEWYHQRYNAKNKIRLALFAGV 

Structure Picture