Em.hu-MSRA-2-U

General Information

Protein ID
110 
External ID
 

Protein Information

Protein Name
Em.hu-MSRA-2-U 
Family
MSRA 
Species
Emiliania huxleyi 
Genome
KB865754 
EST
gi|261447774|gb|FP222320.1|FP222320,gi|261423168|gb|FP182444.1|FP182444,gi|261455290|gb|FP213018.1|FP213018,gi|261447603|gb|FP222164.1|FP222164,gi|261451989|gb|FP224716.1|FP224716,gi|261453910|gb|FP214515.1|FP214515,gi|261458113|gb|FP234844.1|FP234844,gi|261452996|gb|FP233317.1|FP233317,gi|261447648|gb|FP222258.1|FP222258,gi|261438579|gb|FP187367.1|FP187367,gi|261438770|gb|FP199100.1|FP199100,gi|261423219|gb|FP182549.1|FP182549,gi|261449507|gb|FP165693.1|FP165693,gi|261459080|gb|FP224608.1|FP224608 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGGCGCGTCCATTTGCCCGAAGCTGCCCGAGCCCGTTCAAAGCCCGTCAGCCTGCACGCTCACACTCGCGCTCGGGTGATTCTGGCACCCTGAGGAGGAGCTTGCAGCTCTCCCCGGGGTCTCGGAGACCGTGGTTGGCTACTGCGGTGGCAGCACCGCCGATCCGACCTACAAGTCGATTGGCGATCACACAGAGGCCTTGCGTGTCACCTTCGACTCGCGTGTGGTGTCGGCGGAGAGCATGCTCGAGCGCTTCTTTGAGATGCACGACCCGATGCCGCGTGCCTTCACGGGCACTCAGTACCGCTCCGCCATCTTCTATCACAACGACGCGCAGGCCGAGACGGCGGCGGCCGTGGCGGGCCGGCAGGCGTCCTCGCAAGCGAAGCACACCTCGATCGAGCCGGCCGGTCCATTTTACCGCGCTGAAGAGTACCACCAGCGCTTTCTGGCTAAGCAGACGGGGCGGTGGGCAGCTTCGCCCAGCAGATAG 
Protein Sequence
MGASICPKLPEPVQSPSACTLTLALGUFWHPEEELAALPGVSETVVGYCGGSTADPTYKSIGDHTEALRVTFDSRVVSAESMLERFFEMHDPMPRAFTGTQYRSAIFYHNDAQAETAAAVAGRQASSQAKHTSIEPAGPFYRAEEYHQRFLAKQTGRWAASPSR* 
SECIS Sequence
PSACTLTLALGUFWHPEEELAALPGVSETVVGYCGGSTADPTYKSIGDHTEALRVTFDSRVVSAESMLERFFEMHDPMPRAFTGTQYRSAIFYHNDAQAETAAAVAGRQASSQAKHTSIEPAGPFYRAEEYHQRFLAKQTGRWAA 

Structure Picture