2_Mi.49_SELENOH_E

General Information

Protein ID
105 
External ID
 

Protein Information

Protein Name
2_Mi.49_SELENOH_E 
Family
SELENOH 
Species
Micromonas sp. CCMP490 
Genome
 
EST
gi|110154387|gb|EC847790.1|EC847790,gi|110152202|gb|EC845605.1|EC845605 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GTCACGTACTGCAAGAACTGAGACGGGGGCCAGCAGGAGTACAACGCTGCTAAGGATGCTATCACGCGCGTGCACAAGAACGCGACGGTGGTCCCGAACCGCGTAGACTCCTACCCAATCACCGTTACCGTGACGCAGAACTCGGAAACCATCTGGAGTGGCAAGCAACAGGCTTTGTTTGGCAAAAACGGACGCCCCGCGCAGGGCGAAATAATAGCCGCCCTGACGAAACGAGGGTAA 
Protein Sequence
VTYCKNUDGGQQEYNAAKDAITRVHKNATVVPNRVDSYPITVTVTQNSETIWSGKQQALFGKNGRPAQGEIIAALTKRG* 
SECIS Sequence
 

Structure Picture