Mi.pu-SELENOH-1-U

General Information

Protein ID
1038 
External ID
 

Protein Information

Protein Name
Mi.pu-SELENOH-1-U 
Family
SELENOH 
Species
Micromonas pusilla CCMP1545 
Genome
GG663746 
EST
gi|303286852|ref|XM_003062670.1| 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCACCGAAGAAGAAGACACCCGCGAAGAAGGCGGCCGTGGCCGTCAAGAAGACGATCGCCAAGAACGCCCCGATCGCCGCGGACGACGCCGTCGCCGCGGTCCCCAAGGGCGGCGTCCTCATCGAGGCGTGCAAGTCGTGAAACGCGTTCAAGACGCGCGCGAACGCGGTCGCCGCGTTCGTGGCGAAGGCGAAGAAGGGCGCGGTCGTATCGATCAACCCGGTGAAGCCCCGGAAGGGATGCTTCGTGATCAAGACGGAGATGAAGACCGTGGTCGAGCTGTTAAACCTCGCGAGGCCGTTTCCGAAGCTCAAAGCGCTGGACATGGACAAGGTCGGCGCGGACACGGTCGCGGCGCTCTAA 
Protein Sequence
MAPKKKTPAKKAAVAVKKTIAKNAPIAADDAVAAVPKGGVLIEACKSUNAFKTRANAVAAFVAKAKKGAVVSINPVKPRKGCFVIKTEMKTVVELLNLARPFPKLKALDMDKVGADTVAAL* 
SECIS Sequence
MAPKKKTPAKKAAVAVKKTIAKNAPIAADDAVAAVPKGGVLIEACKSUNAFKTRANAVAAFVAKAKKGAVVSINPVKPRKGCFVIKTEMKTVVELLNLARPFPKLKALDMDKVGADTVAAL 

Structure Picture