1_Mi.49_SELENOH_E

General Information

Protein ID
1037 
External ID
 

Protein Information

Protein Name
1_Mi.49_SELENOH_E 
Family
SELENOH 
Species
Micromonas sp. CCMP490 
Genome
 
EST
gi|110155008|gb|EC848411.1|EC848411 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GTGACGTACTGCCAGAACTGAGACGGGGGCGGGCAGGAGTTCAACGCCGCGCGCGATGCTATCCTGTCCGTGGTTGCTGGCGCGGAGGTGGTGGGACACAAAATCGACTCGTACCCGATCACGGTCACGGTGAGTAGGGGCGAGACGCAGATTTGGACCGGCCGGCAACAAGGTTTGTTTGGGAAACACGGACGCCCCGCGCAGGCGGAAATCGCGGCGGCGCTCAAAGCGATGGGGGCCAAATAA 
Protein Sequence
VTYCQNUDGGGQEFNAARDAILSVVAGAEVVGHKIDSYPITVTVSRGETQIWTGRQQGLFGKHGRPAQAEIAAALKAMGAK* 
SECIS Sequence
 

Structure Picture