3_Mi.co_MSRA_Mg

General Information

Protein ID
1026 
External ID
 

Protein Information

Protein Name
3_Mi.co_MSRA_Mg 
Family
MSRA 
Species
Micromonas commoda 
Genome
CP001325 
EST
gi|255075086|ref|XM_002501172.1| 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGGCAACGTCACCGGCCGCATCGCGGCGGATCTCGGCATCCCGGGCAAGTCCTGGCCCACCCCGCGAACCACCGAGTCGGAGTTCGCGGCGCTGACCCGGTCCGACGGCAACCTGGACCGGGCCACCTTCGGCGCGGGATGCTACTGGGGAACGGAATCCTTTTTCGCGAACAACTTTGAGACGAAGCGCCCGGGATGCGTCCGCGCCACGTCGGTGGGGTTCATGGGGCCCGAACCTCCGAGGGAGGGCGAGTTCCCGACGTACAAGGAGGTGTGCACGGGTCGCACGGGCCACGTCGAGGTTGTCCAGATCGTGTACGATACGACGAAGTGCTCGTACGAGGAACTCAACGAGCACCTCTACACCTTCCACGATCCGACGACGAAGAATCGACAGGGGAACGATCACGGGCCGCAGTACGCCAGCGTGGTGTTCGCGCACGACGAGTCGCAGAGGAAAACCGCGGAGAAGGTAAAGGCTAAGGTGCAGAGGGCGCTGGACGCGGGGGAGATTACGGACTACGCCGGCGCGAAGGTTCACACCGCCGTCGAGGACGCCACGGTGTTCTTCCCCGCGCACGAAGACCACCAGCGTTACCTGGAGAAACGTCCGGGGGGGTACTGCAACCACAGGCGGCGGTTCAGCTGGGAGGGCGTCAAACTCGGTAGGATGTGA 
Protein Sequence
MGNVTGRIAADLGIPGKSWPTPRTTESEFAALTRSDGNLDRATFGAGCYWGTESFFANNFETKRPGCVRATSVGFMGPEPPREGEFPTYKEVCTGRTGHVEVVQIVYDTTKCSYEELNEHLYTFHDPTTKNRQGNDHGPQYASVVFAHDESQRKTAEKVKAKVQRALDAGEITDYAGAKVHTAVEDATVFFPAHEDHQRYLEKRPGGYCNHRRRFSWEGVKLGRM* 
SECIS Sequence
ATFGAGCYWGTESFFANNFETKRPGCVRATSVGFMGPEPPREGEFPTYKEVCTGRTGHVEVVQIVYDTTKCSYEELNEHLYTFHDPTTKNRQGNDHGPQYASVVFAHDESQRKTAEKVKAKVQRALDAGEITDYAGAKVHTAVEDATVFFPAHEDHQLRVASRARTRLRLWLURGWGRRRRRPRGSRSTHPRRRSMLHPTPRRFRLDSPGSTRSJPPCTRTRRRRRRUSSGCSRJC 

Structure Picture