Mi.49-MSRA-1-U

General Information

Protein ID
1021 
External ID
 

Protein Information

Protein Name
Mi.49-MSRA-1-U 
Family
MSRA 
Species
Micromonas sp. CCMP490 
Genome
 
EST
gi|110154208|gb|EC847611.1|EC847611 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
TCCACTTCCGCCACGTCCACCTCGAATCTGGATGCCAATCAGGAAACCGCGCTGTTCGCGATGGGATGATTTTGGGGTCCCGAGGAGGATTTCTCCTCGGTGCCTGGCGTGGTCGGTACGATGGTTGGGTACACCGGTGGCGAGACCTCCAGCCCGAGTTACGGCAGCGTGTGTGGAGGCGACGGGCACACGGAGGCGCTTAAGGTGACCTTCGACCCGGCAGTCGTGAGCTTCGAGAAACTTTTAGACACGTTCCTATCGGCGCACGACCCGTGCGTTTCGACGTCCGCGCAGTACCAAAGCGCGGTGTGGCCCACGACGGAAACTCAAAAAACAGCGGTACTCGCTGCGCTGACAGCGCTGGAGCAGAAAAGGGGCCGGCCGGTGTACACCAAAATCGCGGCGCCGAAAACCTGGCACGACGCGGAGTGGTACCACCGGCGGTACCATCTGAAAAACAAGCTTCGCCTCGGCGCCGCCGCCGGCGTGTTTGTGCTGAACAACATGCCGCACGGAAGCTTCCCCGGCCAGGAAGCGCTGAAAACGTTGTTGGGAGGCGCCGTGTTCCTTTCCCTGGTTCCACAGCTCGTCGCGCCATTCGACGAGCTGCTCGCGATCTTC 
Protein Sequence
STSATSTSNLDANQETALFAMGUFWGPEEDFSSVPGVVGTMVGYTGGETSSPSYGSVCGGDGHTEALKVTFDPAVVSFEKLLDTFLSAHDPCVSTSAQYQSAVWPTTETQKTAVLAALTALEQKRGRPVYTKIAAPKTWHDAEWYHRRYHLKNKLRLGAAAGVFVLNNMPHGSFPGQEALKTLLGGAVFLSLVPQLVAPFDELLAIF 
SECIS Sequence
 

Structure Picture