1_Fr.cy_SELENOM_E

General Information

Protein ID
102 
External ID
 

Protein Information

Protein Name
1_Fr.cy_SELENOM_E 
Family
SELENOM 
Species
Fragilariopsis cylindrus 
Genome
 
EST
gi|282254560|gb|GW069938.1|GW069938,gi|282259042|gb|GW073059.1|GW073059,gi|282262927|gb|GW077030.1|GW077030,gi|282262854|gb|GW076957.1|GW076957,gi|282257347|gb|GW074767.1|GW074767 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTTGCTGTCAATCAGCTTCACTCTGACACTTGTACTCGCGTCAATAAGTACATTCGTCGCTGGTGGAACAATTACGGGGAAAGTTGTATCTTGTCCTGCCTGAACCTTAAATAAACACAAGGAATTACGTATATTCCTTAAGGGCGAGTCTCCATCTTCCTCTTCATCTTCTGCTGGTAGAGCGAAACCAGTTGGTGAGATCATGGAATATGATGGTATTACTATTGATTGGGTTAGAGGGAAGAAAGCAATATTAACAATATACGATGAAGATGGAAAACAAATTAAGGACGTACCATTATTTGAATTAAAAACAAGAAAGGATATGCATCAATTTATGATAGATGAAGGATTTCATAAAAAAACACAACAAGAAAAGGTAGAAGAAATACAAGTAGAGAGAAGAGAAAAACAATTAGAACAAATATCAGATGGTGGTCCATCATCATTTTATAATACGATAACAGGTCTATACGTTATGGTGTTTGTAGTTCTTGCTGGGGTTGCATTTGTTCTACGTGGAAAGAAAAAGATAAGAACAGGAACAGGGACACTCAGTATCAGTAGGGTGTAG 
Protein Sequence
MLLSISFTLTLVLASISTFVAGGTITGKVVSCPAUTLNKHKELRIFLKGESPSSSSSSAGRAKPVGEIMEYDGITIDWVRGKKAILTIYDEDGKQIKDVPLFELKTRKDMHQFMIDEGFHKKTQQEKVEEIQVERREKQLEQISDGGPSSFYNTITGLYVMVFVVLAGVAFVLRGKKKIRTGTGTLSISRV* 
SECIS Sequence
 

Structure Picture