Eu.gr-MSRA-1-U

General Information

Protein ID
1018 
External ID
 

Protein Information

Protein Name
Eu.gr-MSRA-1-U 
Family
MSRA 
Species
Euglena gracilis 
Genome
 
EST
gi|109786080|gb|EC678476.1|EC678476 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCGGCAGCAGGGCCAGGGAGGGGTGGACGCTCAGCCGACGGCCTTCCGCACCATCGCCTTGGCAGCGGAGGGGCCAAGGGATTCCAAGGAGCGGCTGCCGCTGACCCGGGCGACCCCGAGCCTCCTCCGCCCGGCGGCGGCGGGGTGGCCGGAGGTCGCCACGTTCGCCATGGGCTGATTCTGGCACCCCGAGGCGACCTTCGGGTCGCTT 
Protein Sequence
MRQQGQGGVDAQPTAFRTIALAAEGPRDSKERLPLTRATPSLLRPAAAGWPEVATFAMGUFWHPEATFGSL 
SECIS Sequence
 

Structure Picture