Em.hu-SELENOM-5-U

General Information

Protein ID
1014 
External ID
 

Protein Information

Protein Name
Em.hu-SELENOM-5-U 
Family
SELENOM 
Species
Emiliania huxleyi 
Genome
KB867414 
EST
gi|261450865|gb|FP225244.1|FP225244,gi|261432464|gb|FP229341.1|FP229341,gi|261442077|gb|FP188166.1|FP188166,gi|261422070|gb|FP180920.1|FP180920,gi|261425839|gb|FP193456.1|FP193456,gi|261440602|gb|FP173140.1|FP173140,gi|261441193|gb|FP198424.1|FP198424,gi|261430274|gb|FP218182.1|FP218182,gi|261454876|gb|FP203702.1|FP203702,gi|261426800|gb|FP170254.1|FP170254,gi|261446440|gb|FP178367.1|FP178367,gi|261445429|gb|FP179977.1|FP179977 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGCACACGCGCGTCCTCGTTCTCGCCGCGCTCGTCGCCACAACGACCGCAGCGCCGTCGGACACGTACACGGGAACAGTGGTCTCGTGCGATCGATGATCCCTCAACGCGCTCCCGAAGGTGAAGAGATTCGTCTGTATGTTTCTTCCCCGCCCTTGCGCCAAGAACTTCAAAGGGCGAAGGCCGGGCGCGGAGATGTTCAGCGGAGTCGAGTACAAGTGGATTTTTCACCACCAGCCCGAGCTCCAGATCTTTAAGAACGGTGGCAGCGCCCCGTTCAAGGTCGTGAAGCTGGCGCCGATGGACGAGGCGCAGCTGAACGAGCTCTGGTCTACTTATTTCCCGAAGGCGGCGCAGCGCCGACTCTCGGACGCGGACGCTCCTGTCCCGCTGCCAGATCGACAGGCTGGCGCATAG 
Protein Sequence
MHTRVLVLAALVATTTAAPSDTYTGTVVSCDRUSLNALPKVKRFVCMFLPRPCAKNFKGRRPGAEMFSGVEYKWIFHHQPELQIFKNGGSAPFKVVKLAPMDEAQLNELWSTYFPKAAQRRLSDADAPVPLPDRQAGA* 
SECIS Sequence
MHTRVLVLAALVATTTAAPSDTYTGTVVSCDRUSLNALPKVKRFVCMFLPRPCAKNFKGRRPGAEMFSGVEYKWIFHHQPELQIFKNGGSAPFKVVKLAPMDEAQLNEL 

Structure Picture