Au.an-SELENOH-1-U

General Information

Protein ID
10 
External ID
 

Protein Information

Protein Name
Au.an-SELENOH-1-U 
Family
SELENOH 
Species
Aureococcus anophagefferens 
Genome
ACJI01002319 
EST
gi|161687817|gb|FC046384.1|FC046384 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCGCCGAAACGCAAGGCCTCCGCGAAGCAGGACAGCGAGCCGAAGAAGGCGGCGAAGACGAAGGCGGACGCGCCGCCGTCGGAGGGCGGCGTCGTCGTCGTCGAGGCCTGCAAGAGCTGAGGCGCGTTCAAGACCCGCGCGAACAAGGTCTTGAAGGCTTTGGAAGGCAAGGCGGAGGTGAAGATCAACGAGGAGAAGCCGCGCAAGGGCGCCTTCGTCGTCTCCGTCGGCGACACAAAGGTCGTCGAGCTCCTCGACATGAAGCGGCCGTTCCCGGCGCTGAAGGCGCTGGACATGGACGACGTCGCCGCGGACGTCGAGAAGGCGCTGGCCGCG 
Protein Sequence
MAPKRKASAKQDSEPKKAAKTKADAPPSEGGVVVVEACKSUGAFKTRANKVLKALEGKAEVKINEEKPRKGAFVVSVGDTKVVELLDMKRPFPALKALDMDDVAADVEKALAA 
SECIS Sequence
MAPKRKASAKQDSEPKKAAKTKADAPPSEGGVVVVEACKSUGAFKTRANKVLKALEGKAEVKINEEKPRKGAFVVSVGDTKVVELLDMKRPFPALKALDMDDVAADVEKALAA 

Structure Picture